PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_18441.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HB-PHD
Protein Properties Length: 1240aa    MW: 137268 Da    PI: 4.425
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_18441.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.31.7e-10563613252
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                    kR++f +   e+L+++F  ++yps++ +e LA++lgLt rqV  WF   R
  MLOC_18441.2 563 AKRRQFGPVINERLNQHFTTEQYPSRALKESLAQELGLTFRQVNKWFESTR 613
                   68999999999************************************8766 PP

2Homeobox352.4e-11106511081356
                    HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56  
                    ++L e Fe n+yps++ +e LA++lgLt rqV  WF  +R + +
  MLOC_18441.2 1065 QRLHEQFETNPYPSRAVKESLARELGLTFRQVERWFESKRRRLR 1108
                    6899************************************9976 PP

3PHD38.62.4e-13223278151
                   SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
           PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                   +C+ C+    + +++++lCdg C++ fH++Cl+++l ++++peg   wlC+ C++k
  MLOC_18441.2 223 VCATCSLqdVTLNNDIILCDGaCDRGFHQNCLNPPLLTKDIPEGeeGWLCPACDCK 278
                   5999998544459*******66*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.09E-13213281IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.2E-12220277IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.825221278IPR019787Zinc finger, PHD-finger
SMARTSM002492.5E-10223276IPR001965Zinc finger, PHD-type
CDDcd155041.03E-24223275No hitNo description
PfamPF006282.4E-10224278IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590224275IPR019786Zinc finger, PHD-type, conserved site
SuperFamilySSF466894.71E-11555614IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-13555613IPR009057Homeodomain-like
PROSITE profilePS5007113.604559619IPR001356Homeobox domain
CDDcd000861.46E-10562613No hitNo description
SMARTSM003892.7E-9562623IPR001356Homeobox domain
PfamPF000465.3E-8563613IPR001356Homeobox domain
PROSITE profilePS5007114.80310501110IPR001356Homeobox domain
SMARTSM003891.2E-1010531114IPR001356Homeobox domain
CDDcd000862.62E-1210551108No hitNo description
SuperFamilySSF466895.13E-1210591117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1210651119IPR009057Homeodomain-like
PfamPF000461.1E-810651108IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1240 aa     Download sequence    Send to blast
MDKSNTSGSA EGVIETQNYA NSSLNTETLK HQSFPIPYTS VTGERKNFKR AANRGRKGSR  60
VLSSRTYPLR SSESTVRVLR SRSVADKSPS DAVQIAERAA EKPPRDSVDA VVKPPAKRIK  120
RDRPAKGGPD DELSKIRKRI RYVLNRMNYQ QSFLEAYANE GWKNQSLEKI RPEKELERAK  180
AEIMRCKLRI REAFQNLDHL LTLGKLEESL FDSEGEISSD DIVCATCSLQ DVTLNNDIIL  240
CDGACDRGFH QNCLNPPLLT KDIPEGEEGW LCPACDCKID CIELINELQG TDLDINDSWE  300
KVFPEAAAVA HGSMQNDIPD LPSDDSEDDD FDPNISEEHV SGHVEGSSEE EGDEGSDSDD  360
SNFITSSENS EHVKEKEKVD DLGLPSEDSE DDDYDPEGPD SDKDIEEKQD ESDFTSDSDD  420
FCAEITKSCG KDEVSSGPKV GGRTNDLEGA PVRPNTSMSH LTTKDLEIDQ DVILSSRRRQ  480
VQQLDYKKLY DDAYGEAPSD SSDAEEWSGK STLKEDNEER NEVDSFACKS SRGTRAVHPD  540
SFHGLVNDQH AGGLTSDGSN SKAKRRQFGP VINERLNQHF TTEQYPSRAL KESLAQELGL  600
TFRQVNKWFE STRHARATAM KNGIQLEKHS NSRKKKSSEV THMEVSDQPN ACKEEGIRQD  660
SPVKQDTDGG QRTHVPPESS QSYTKTSGLV GCPKSESRKN HEKNTSSKYV GIPTDGSAED  720
QILGLEREDE GSDSDDLNFV IHSGNSEPLK NREKVDDLEL PSAYSEDDDY DSDEDTENMQ  780
QCSDESDADE CSDESDADES NFITSSDNPE DVKEKVDDLR LPSEDSEDDD YDPAGPDSDE  840
GIGKKQSSSD KSLSSDKSEN TKMKKKVDDL GLPSEDSEDD DYHPASPDSD KDIEEKQEDS  900
EDDDFSSDSD DFCDKIAKSC CGREGVPSGA KVDRDRTNDL EGTTICATAA ISNLPSKDAE  960
MGQYVVLPVS ARQQVQSPDS KKLYAAHGKA PSDLSYSEDL SKKGTPEKDN GKESEAGSFV  1020
NEFTLQRSQQ SLHGSVNGQH AEELLTPNGS STTGQKRQYG PIINQRLHEQ FETNPYPSRA  1080
VKESLARELG LTFRQVERWF ESKRRRLRVA SSKNSTSVEN HSSKETMVEN PNICKSDAVN  1140
EDTPSGILNE GITQDGPLKQ DIGGGLRTNV SPQNSSERYT YPLVKRPKGE SRENHMKNTS  1200
SSGAGRPEGS DAGCVVLALE AVDEKTRDKM LQELKKRKIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140KIRKRIR
211021106KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686280.0AK368628.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077C19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754575.10.0PREDICTED: homeobox protein HOX1A-like isoform X3
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLM0V5210.0M0V521_HORVD; Uncharacterized protein
STRINGMLOC_18441.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-78Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain